PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG094400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 425aa    MW: 46943.7 Da    PI: 9.6617
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG094400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.6e-24156200145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  Pavir.9NG094400.1.p 156 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 200
                          79****************************************997 PP

2QLQ55.22.2e-1998133237
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          +FT++Q+++L++Q+l+yKyL a++P+P+ Ll  i+k
  Pavir.9NG094400.1.p  98 PFTPSQWMELEHQALIYKYLHAKAPIPSSLLISISK 133
                          9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-1097133IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.1E-1498131IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.43398133IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803156200IPR014977WRC domain
PfamPF088793.7E-20157199IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MSATEFRSAG AAAMEFGEVM GLQQGIAGTA PSPREGDLGL LKRAGLTQAA AAAASHPSPF  60
LDEQKMLRFS KAAQALPSGL DLGRPNEQAF LLSRTKRPFT PSQWMELEHQ ALIYKYLHAK  120
APIPSSLLIS ISKSFRSSNR VSWTPLYQGY TNADSDPEPG RCRRTDGKKW RCSKEAMADH  180
KYCERHINRN RHRSRKPVEN QPKKTAKEAP AGSLPCAVSQ GSLKKAKVND SKPGTVSYWT  240
DSLNRTMLSK EKANQSTEDN SAPLLNSTNR QPTLSLLSQL KQHNKPDKFS PAVHSDTILK  300
AWESRNQPIH KSISSTQLHD AESLQSVLQN FSLEKNENMD SERNKYSDSM LVSSTSYHST  360
QGPQTTCLIP NMTQVQADCI SSSWEMPQGG PLGEILTNSK NNDDSNKKCE SRSYGWLLNL  420
DHSP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.73130.0callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982189.10.0PREDICTED: growth-regulating factor 9-like
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLK4AA870.0K4AA87_SETIT; Uncharacterized protein
STRINGSi035794m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-37growth-regulating factor 1